PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.1G076400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 372aa    MW: 40335.5 Da    PI: 7.6323
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.1G076400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.98.4e-172774148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEde+lv  v+++G g+W+++ r+ g++R++k+c++rw ++l
  Sevir.1G076400.1.p 27 KGSWTAEEDEKLVGHVQRHGEGNWDKVRRKTGLRRCGKSCRLRWTNHL 74
                        799******************************************996 PP

2Myb_DNA-binding27.85.8e-0980110132
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmg 32 
                         rg++++eE++l+++++++lG++ W++Ia+++ 
  Sevir.1G076400.1.p  80 RGAMSPEEELLFLRLHALLGNK-WARIAAHVE 110
                         899*******************.******985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-232177IPR009057Homeodomain-like
PROSITE profilePS5129425.0772278IPR017930Myb domain
SMARTSM007173.1E-142676IPR001005SANT/Myb domain
PfamPF002491.6E-142774IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-2328105IPR009057Homeodomain-like
CDDcd001672.33E-122974No hitNo description
PROSITE profilePS500905.70375119IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.1E-1078110IPR009057Homeodomain-like
SMARTSM007170.5579118IPR001005SANT/Myb domain
PfamPF002491.0E-780109IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MARDEGSTKR SVEKKQAPGE EDASLKKGSW TAEEDEKLVG HVQRHGEGNW DKVRRKTGLR  60
RCGKSCRLRW TNHLRPDLKR GAMSPEEELL FLRLHALLGN KWARIAAHVE HEVALIRAGG  120
PNTILDAGAD DRVKPQERPP FLFDAADPLT LLSLPPPASD SPAAIYHFGM AAREPRPLPS  180
IDDLKIDPSN YLPLAPLLPP MAHRELPSIQ SAAIATGATL ETAFLCDPEH QQVAAAASLV  240
NFGTMPGLVS HENIDSSGPS GGRSSRSEGG DTPLHCTQEE GLLNLGGKRG CLSGDDEKPA  300
KKPLASRAAD DEEMPNLSPP IRRSSSSQPS GASMRRCSSL PAYDPVRAAD LRRRRVEPMN  360
SPRDHVNFFG I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-1625106585B-MYB
1h8a_C4e-162510625105MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954707.11e-102PREDICTED: transcription factor MYB104-like
TrEMBLA0A0A9KTW65e-68A0A0A9KTW6_ARUDO; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP2537733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G10280.11e-28myb domain protein 92